PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR04G14700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 271aa    MW: 30184.7 Da    PI: 7.2054
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR04G14700.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.9e-182471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT +Ed llv+ v+q+G g+W+++++  g++R++k+c++rw +yl
  LPERR04G14700.1 24 KGPWTSQEDTLLVEHVRQHGEGRWNSVSKLTGLKRSGKSCRLRWVNYL 71
                     79********************************************97 PP

2Myb_DNA-binding54.33.1e-1777121147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T++E+ ++v++++++G++ W+tIar ++ gRt++++k++w+++
  LPERR04G14700.1  77 RGKITPQEESIIVQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 121
                      8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.2221971IPR017930Myb domain
SuperFamilySSF466891.54E-2922118IPR009057Homeodomain-like
SMARTSM007172.3E-152373IPR001005SANT/Myb domain
PfamPF002498.6E-172471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-232578IPR009057Homeodomain-like
CDDcd001678.84E-122671No hitNo description
PROSITE profilePS5129425.39672126IPR017930Myb domain
SMARTSM007176.6E-1676124IPR001005SANT/Myb domain
PfamPF002499.6E-1577121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-2479124IPR009057Homeodomain-like
CDDcd001673.36E-1181122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MATAEVQSAP GWGRQQQDGG GWRKGPWTSQ EDTLLVEHVR QHGEGRWNSV SKLTGLKRSG  60
KSCRLRWVNY LRPDLKRGKI TPQEESIIVQ LHALWGNRWS TIARSLPGRT DNEIKNYWRT  120
HFKKGKPSKN IERARARFLK QRREMQQQSQ QQHHQPPPQT KVDDVAVVEA GISCTDDDVV  180
AAPPPSSSLP GNNEADQQLI IQDAMDDLMM CPTMSYQLLL HGAVGQLSNG GGSCCASTSE  240
EYGSSEEDGA TWGSLWNLDG VVDHDGACSL W
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-262412427126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096200.0AK109620.1 Oryza sativa Japonica Group cDNA clone:002-138-A05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634463.11e-142PREDICTED: transcription factor WER
TrEMBLA0A0D9W6Y90.0A0A0D9W6Y9_9ORYZ; Uncharacterized protein
STRINGORGLA04G0153500.11e-142(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.13e-63myb domain protein 79